SCF Polyclonal antibody

SCF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 23844-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

KITLG, c Kit ligand, c-Kit ligand, KIT ligand, Kitl

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23844-1-AP targets SCF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20837

Product name: Recombinant human SCF protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-273 aa of BC074725

Sequence: MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV

Predict reactive species
Full Name KIT ligand
Calculated Molecular Weight 273 aa, 31 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC074725
Gene Symbol SCF
Gene ID (NCBI) 4254
RRIDAB_3669419
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDP21583
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand, steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on inflammation, tissue remodeling, and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID: 23073628). SCF is the ligand of c-Kit, a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility, and expression of the SCF/c-Kit axis is associated with cell migration (PMID: 28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a well-described role in regulating the survival, proliferation, migration, and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID: 36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells, and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID: 18200049, PMID: 30157426).

Protocols

Product Specific Protocols
IF protocol for SCF antibody 23844-1-APDownload protocol
IHC protocol for SCF antibody 23844-1-APDownload protocol
WB protocol for SCF antibody 23844-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (08-12-2025)

Worked well for western in MSCs, showed a non specific band at 70 kDa, but also detected the protein.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MSCs
Loading...
||
New chat

Able

正在加载,请稍候...