Mouse SCF Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86214-1-RR (same clone as 86214-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86214-1-RR (SCF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86214-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 86214-1-RR (same clone as 86214-1-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 86214-1-RR (SCF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86214-1-PBS in a different storage buffer formulation.

SCF Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86214-1-PBS

Clone No.250022H6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Kitl, kit ligand

---

Product Information

86214-1-PBS targets SCF in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0402

  Product name: Recombinant Mouse SCF protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-189 aa of NM_013598

  Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

• Full Name: kit ligand
• Calculated Molecular Weight: 31KD
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_013598
• Gene Symbol: Kitl
• Gene ID (NCBI): 17311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20826-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Stem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand, steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on inflammation, tissue remodeling, and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID: 23073628). SCF is the ligand of c-Kit, a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility, and expression of the SCF/c-Kit axis is associated with cell migration (PMID: 28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a well-described role in regulating the survival, proliferation, migration, and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID: 36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells, and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID: 18200049, PMID: 30157426).