SCFD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SCFD2 Polyclonal antibody (13375-1-AP)

SCFD2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13375-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Sec1 family domain-containing protein 2, STXBP1L1, Syntaxin-binding protein 1-like 1

• 

  WB analysis using 13375-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13375-1-AP (SCFD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of COLO 320 using 13375-1-AP

  IP result of anti-SCFD2 (IP:13375-1-AP, 4ug; Detection:13375-1-AP 1:600) with COLO 320 cells lysate 1680 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13375-1-AP (SCFD2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13375-1-AP (SCFD2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 13375-1-AP (SCFD2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13375-1-AP (SCFD2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13375-1-AP (SCFD2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13375-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13375-1-AP (SCFD2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IP detected in: COLO 320 cells
• Positive IHC detected in: human colon cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13375-1-AP targets SCFD2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4197

  Product name: Recombinant human SCFD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC032453

  Sequence: MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAESLHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQPKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVTTVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKLCEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFASLFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTPELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTGAVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALTALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNTK

• Full Name: sec1 family domain containing 2
• Calculated Molecular Weight: 684 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC032453
• Gene Symbol: SCFD2
• Gene ID (NCBI): 152579
• RRID: AB_10646473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WU76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Biol Cell; An integrated proximity labeling and vesicle reconstitution assay identifies novel regulators of Sonic hedgehog secretion.; Authors - Ziyang Song ; KD Validated