Tested Applications
| Positive WB detected in | SH-SY5Y cells |
| Positive IHC detected in | mouse pancreas tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20357-1-AP targets Secretogranin II in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14215 Product name: Recombinant human SCG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 418-617 aa of BC022509 Sequence: TPGGAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM Predict reactive species |
| Full Name | secretogranin II (chromogranin C) |
| Calculated Molecular Weight | 617 aa, 71 kDa |
| Observed Molecular Weight | 71 kDa |
| GenBank Accession Number | BC022509 |
| Gene Symbol | Chromogranin C/SGII |
| Gene ID (NCBI) | 7857 |
| RRID | AB_10699881 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13521 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCG2, also known as secretogranin II or Chromogranin C, is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is widely distributed in nervous and endocrine tissues, and abundant in neuroendocrine granules. In the brain secretogranin II is almost completely processed to secretoneurin, a peptide involved in neurite outgrowth, neuroprotection and neuronal plasticity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Secretogranin II antibody 20357-1-AP | Download protocol |
| IHC protocol for Secretogranin II antibody 20357-1-AP | Download protocol |
| WB protocol for Secretogranin II antibody 20357-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Secretogranin II Polyclonal antibody (Cat# 20357-1-AP) has 13 citations spanning journals including Nature, Cell Reports, Journal of Cell Biology, Molecular Oncology, Apoptosis, NPJ Digital Medicine, Cancer Medicine, Frontiers in Molecular Biosciences, Frontiers in Physiology, Frontiers in Neurology, Frontiers in Cardiovascular Medicine, Journal of Cell Science, and Journal of Biomedical Research. Research fields cover neuroscience, oncology, vesicle trafficking/exocytosis, cardiovascular disease, and gut-brain interactions.
| Species | Application | Title |
|---|---|---|
NPJ Digit Med Targeting m6A-SCG2-TAMs axis overcomes 5-FU resistance in colorectal cancer via a multi-omics model. | ||
Apoptosis Promoting effect and immunologic role of secretogranin II on bladder cancer progression via regulating MAPK and NF-κB pathways
| ||
Cell Rep Gut microbiota shapes social dominance through modulating HDAC2 in the medial prefrontal cortex. | ||
J Cell Biol SNX5 targets a monoamine transporter to the TGN for assembly into dense core vesicles by AP-3. | ||
Mol Oncol Secretogranin II impairs tumor growth and angiogenesis by promoting degradation of hypoxia-inducible factor-1α in colorectal cancer. |
Reviews
What customers say
One reviewer (Wojciech O., March 2023) gave this antibody a 5-star rating for Western Blot on T-ALL cell lines using lot 00044023 at a 1:1000 dilution in 5% non-fat milk. The antibody produced a single clean band at approximately 75 kDa, and the reviewer described it as working very well overall.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wojciech (Verified Customer) (03-02-2023) | The antibody worked very well. The dilution used was 1:1000 in 5% non-fat milk. The single detected band size was around 75 kDa.
|
