Home
Products
Primary Antibodies
SCGBL Polyclonal antibody, PBS Only (21142-1-PBS)

Filter: AllIHC

IHC staining of human brain using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 21142-1-AP (SCGBL antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 21142-1-AP (SCGBL antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas slide using 21142-1-AP (SCGBL Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas slide using 21142-1-AP (SCGBL Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.
IHC staining of human prostate hyperplasia using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia slide using 21142-1-AP (SCGBL Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.
IHC staining of human prostate hyperplasia using 21142-1-AP (same clone as 21142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia slide using 21142-1-AP (SCGBL Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21142-1-PBS in a different storage buffer formulation.

SCGBL Polyclonal antibody, PBS Only

Name: SCGBL Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21142-1-PBS

SCGBL Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21142-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21142-1-PBS targets SCGBL in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15610 Product name: Recombinant human SCGBL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-96 aa of BC093909 Sequence: CLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANVSVTERFAHSVVIKKILQSNDCIEAAF Predict reactive species
Full Name	secretoglobin-like
Calculated Molecular Weight	96 aa, 11 kDa
GenBank Accession Number	BC093909
Gene Symbol	SCGBL
Gene ID (NCBI)	284402
RRID	AB_2878818
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q4G0G5
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.