SCML4 Polyclonal antibody

• 

  WB analysis of mouse liver using 25439-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25439-1-AP (SCML4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 25439-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 25439-1-AP (SCML4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25439-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25439-1-AP (SCML4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

SCML4 Polyclonal Antibody for WB, ELISA

Cat No. 25439-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

SCML4

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A375 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25439-1-AP targets SCML4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22157

  Product name: Recombinant human SCML4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-305 aa of BC033286

  Sequence: AKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH

• Full Name: sex comb on midleg-like 4 (Drosophila)
• Calculated Molecular Weight: 414 aa, 45 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC033286
• Gene Symbol: SCML4
• Gene ID (NCBI): 256380
• RRID: AB_2880081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.