SCNM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SCNM1 Polyclonal antibody, PBS Only (15490-1-PBS)

• 

  IHC staining of mouse brain using 15490-1-AP (same clone as 15490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15490-1-AP (SCNM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15490-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15490-1-AP (same clone as 15490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15490-1-AP (SCNM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15490-1-PBS in a different storage buffer formulation.

SCNM1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15490-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

15490-1-PBS targets SCNM1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7854

  Product name: Recombinant human SCNM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC000264

  Sequence: MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD

• Full Name: sodium channel modifier 1
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC000264
• Gene Symbol: SCNM1
• Gene ID (NCBI): 79005
• RRID: AB_2184357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWG6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCNM1 is located at chromosome 1p21 which may contribute to human inherited dystonia. SCNM1 determines the proportion of correctly spliced transcripts and hence disease severity. It plays a role in RNA splicing, possibly contributing to the recognition of non-consensus donor sites.