SCNN1A Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SCNN1A Monoclonal antibody (68581-1-Ig)

SCNN1A Monoclonal Antibody for WB, ELISA

Cat No. 68581-1-Ig Copied!

Clone No. 1C2C2

Reviews (1)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

Alpha ENaC, Alpha NaCH, ENaCa, ENaCalpha, FLJ21883, SCNEA, SCNN1, SCNN1A

• 

  WB analysis using 68581-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68581-1-Ig (SCNN1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SCNN1A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HT-1376 cells, LNCaP cells, SK-BR-3 cells, MDA-MB-231 cells, A549 cells, HT-29 cells, SW480 cells, BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68581-1-Ig targets SCNN1A in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29548

  Product name: Recombinant human SCNN1A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 363-711 aa of BC006526

  Sequence: MPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP

• Full Name: sodium channel, nonvoltage-gated 1 alpha
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: ~80 kDa
• GenBank Accession Number: BC006526
• Gene Symbol: SCNN1A
• Gene ID (NCBI): 6337
• RRID: AB_3085281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37088
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The product received one review with a 4-star rating. The reviewer used it for Western Blot on lung tissue at a 1:500 dilution and described the performance as "Good." Overall, the feedback is positive, indicating reliable results in the tested application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

S (Verified Customer) (06-17-2026)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 500
• Cell Tissue Type: Lung tissue

SCNN1A Antibody Western Blot validation (500 dilution) in Lung tissue (Cat no:68581-1-Ig)