Anti-Mouse SDC2 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse SDC2 Rabbit Recombinant Antibody, PBS Only (98399-1-PBS)

SDC2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98399-1-PBS Copied!

Clone No. 242939A12

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD362, Fibroglycan, Heparan sulfate proteoglycan core protein, HSPG, Hspg1

• 

  FC experiment of Transfected HEK-293T using 98399-1-RR (same clone as 98399-1-PBS)

  1x10^6 HEK-293T cells or SDC2 transfected HEK-293T cells were surface stained with 0.25 ug Anti-Mouse SDC2 Rabbit RecAb (98399-1-RR, Clone:242939A12) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98399-1-RR (same clone as 98399-1-PBS)

  1x10^6 HEK-293T cells(left) or SDC2 transfected HEK-293T cells(right) were surface stained with 0.25 ug Anti-Mouse SDC2 Rabbit RecAb (98399-1-RR, Clone:242939A12)(red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SDC2 in ?

Chat with Able

---

Product Information

98399-1-PBS targets SDC2 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2700

  Product name: Recombinant Mouse SDC2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-145 aa of NM_008304.2

  Sequence: ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTE

• Full Name: syndecan 2
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_008304.2
• Gene Symbol: SDC2
• Gene ID (NCBI): 15529
• RRID: AB_3746043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P43407
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer.