SEC10/EXOC5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87198-1-RR (same clone as 87198-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87198-1-RR (SEC10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87198-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87198-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87280-1-RR against Human SEC10/EXOC5 were performed. The affinity constant is 0.24 nM.

SEC10/EXOC5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87198-1-PBS

Clone No.252196E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EXOC5, Exocyst complex component 5, Exocyst complex component Sec10, hSec10, SEC10

---

Product Information

87198-1-PBS targets SEC10/EXOC5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11524

  Product name: Recombinant human SEC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 359-708 aa of BC041126

  Sequence: SRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLLQETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIRQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS

• Full Name: exocyst complex component 5
• Calculated Molecular Weight: 708 aa, 82 kDa
• Observed Molecular Weight: 70-77 kDa
• GenBank Accession Number: BC041126
• Gene Symbol: EXOC5
• Gene ID (NCBI): 10640
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00471
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. The complex is also essential for the biogenesis of epithelial cell surface polarity. SEC10, as a central component of the eight-protein exocyst complex, plays a crucial role in exocytosis.