SEC22A Polyclonal antibody

• 

  WB analysis using 29179-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29179-1-AP (SEC22A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

SEC22A Polyclonal Antibody for WB, ELISA

Cat No. 29179-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SEC22L2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29179-1-AP targets SEC22A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30293

  Product name: Recombinant human SEC22A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-187 aa of BC007122

  Sequence: YEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEP

• Full Name: SEC22 vesicle trafficking protein homolog A (S. cerevisiae)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC007122
• Gene Symbol: SEC22A
• Gene ID (NCBI): 26984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IW7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.