SEC22B Polyclonal antibody

• 

  WB analysis using 14776-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14776-1-AP (SEC22B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14776-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14776-1-AP (SEC22B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14776-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14776-1-AP (SEC22B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 14776-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 14776-1-AP (SEC22B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 14776-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14776-1-AP (SEC22B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14776-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14776-1-AP (SEC22B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 14776-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14776-1-AP (SEC22B antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 14776-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14776-1-AP (SEC22B antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of MCF-7 using 14776-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 14776-1-AP (SEC22B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SEC22B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14776-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SEC22L1, SEC22 vesicle-trafficking protein-like 1, SEC22 vesicle-trafficking protein homolog B, ERS-24, ERS24

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, rat liver tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human breast cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 4 publications below
• IF: See 3 publications below

Product Information

14776-1-AP targets SEC22B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6077

  Product name: Recombinant human SEC22B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-215 aa of BC001364

  Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

• Full Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001364
• Gene Symbol: SEC22B
• Gene ID (NCBI): 9554
• RRID: AB_2186083
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75396
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; Receptor-Mediated ER Export of Lipoproteins Controls Lipid Homeostasis in Mice and Humans.; Authors - Xiao Wang
mouse	WB,IF	Nat Cell Biol; The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion.; Authors - Maja Petkovic
		Sci Adv; Integrated proteogenetic analysis reveals the landscape of a mitochondrial-autophagosome synapse during PARK2-dependent mitophagy.; Authors - Jin-Mi Heo
mouse	WB	J Neurosci; Unbalanced regulation of Sec22b and Ykt6 blocks autophagosome axonal retrograde flux in neuronal ischemia-reperfusion injury.; Authors - Haiying Li ; KD Validated
rat	WB,IF	Brain Res Bull; Upregulation of Sec22b plays a neuroprotective role in a rat model of traumatic brain injury via inducing protective autophagy.; Authors - Di Li ; KD Validated
human	IF	Nat Commun; Autophagy-independent role of ATG9A vesicles as carriers for galectin-9 secretion; Authors - Wenting Zhang ; KD Validated