SEC22C Polyclonal antibody

• 

  WB analysis using 28078-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 28078-1-AP (SEC22C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 28078-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28078-1-AP (SEC22C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28078-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28078-1-AP (SEC22C antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SEC22C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28078-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

DKFZp761F2321, SEC22C, SEC22L3

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28078-1-AP targets SEC22C in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27896

  Product name: Recombinant human SEC22C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-162 aa of BC018437

  Sequence: TDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVAN

• Full Name: SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC018437
• Gene Symbol: SEC22C
• Gene ID (NCBI): 9117
• RRID: AB_2881053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRL7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.