SEC31A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84942-4-RR (same clone as 84942-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84942-4-RR (SEC31A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84942-4-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 84942-4-RR (same clone as 84942-4-PBS)

  IP result of anti-SEC31A (IP:84942-4-RR, 4ug; Detection:84942-4-RR 1:4000) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 84942-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84942-4-RR (same clone as 84942-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SEC31A antibody (84942-4-RR, Clone: 242531E2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594-Phalloidin (red). This data was developed using the same antibody clone with 84942-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84942-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84942-4-RR against Human SEC31A were performed. The affinity constant is 12.4 nM.

SEC31A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 84942-4-PBS

Clone No.242531E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

242531E2, ABP125, ABP130, KIAA0905, SEC31 like protein 1

---

Product Information

84942-4-PBS targets SEC31A in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12314

  Product name: Recombinant human SEC31A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 758-1106 aa of BC084583

  Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV

• Full Name: SEC31 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1220 aa, 133 kDa
• Observed Molecular Weight: 118-140 kDa
• GenBank Accession Number: BC084583
• Gene Symbol: SEC31A
• Gene ID (NCBI): 22872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O94979
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologs of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed.