SEC61B Recombinant monoclonal antibody

SEC61B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85805-2-RR

Clone No.250082D3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Protein transport protein Sec61 subunit beta

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICCAffinity

WB analysis using 85805-2-RR
Various lysates were subjected to SDS PAGE followed by western blot with 85805-2-RR (SEC61B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
WB analysis of HepG2 using 85805-2-RR
WB result of SEC61B antibody (85805-2-RR; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SEC61B transfected HepG2 cells.
IF Staining of HeLa using 85805-2-RR
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SEC61B antibody (85805-2-RR, Clone: 250082D3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
Affinity of 85805-2-RR
Biolayer interferometry (BLl) kinetic assays of 85805-2-RR against Human SEC61B were performed. The affinity constant is 28.9 pM.

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, HepG2 cells, HEK-293T cells, A431 cells, L02 cells, NIH/3T3 cells, C6 cells
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85805-2-RR targets SEC61B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag7169 Product name: Recombinant human SEC61B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC001734 Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Predict reactive species
Full Name	Sec61 beta subunit
Calculated Molecular Weight	10 kDa
Observed Molecular Weight	10-15 kDa
GenBank Accession Number	BC001734
Gene Symbol	SEC61B
Gene ID (NCBI)	10952
RRID	AB_3744390
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P60468
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408).