P-selectin / CD62P Monoclonal antibody

• 

  WB analysis using 60322-1-Ig

  Untreated and PNGase F-treated lysates of human platelets were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

• 

  WB analysis of human peripheral blood platelets using 60322-1-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 60322-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 60322-1-Ig

  IP result of anti-P-selectin / CD62P (IP:60322-1-Ig, 5ug; Detection:60322-1-Ig 1:600) with K-562 cells lysate 1760ug.

P-selectin / CD62P Monoclonal Antibody for WB, IP, ELISA

Cat No. 60322-1-Ig

Clone No.3G2C7

Publications(34)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IF, IP, ELISA

Synonyms

CD62P, P-selectin, GMP140, GMP 140, CD62 antigen-like family member P

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets, Jurkat cells
• Positive IP detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 28 publications below
• IHC: See 3 publications below
• IF: See 5 publications below
• FC: See 4 publications below

Product Information

60322-1-Ig targets P-selectin / CD62P in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4124

  Product name: Recombinant human SELP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 441-789 aa of BC028067

  Sequence: VCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQDDGKCPLNPHSHLGTYGVFTNAAFDPSP

• Full Name: selectin P (granule membrane protein 140kDa, antigen CD62)
• Calculated Molecular Weight: 830 aa, 91 kDa
• Observed Molecular Weight: 140 kDa, 105-110 kDa
• GenBank Accession Number: BC028067
• Gene Symbol: CD62P
• Gene ID (NCBI): 6403
• RRID: AB_2881433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P-selectin, also known as GMP140 or CD62P, is a transmembrane glycoprotein that mediates the interaction of activated endothelial cells or platelets with leukocytes. It is an adhesion molecule involved in the pathogenesis of inflammation, thrombosis, and oncogenesis. P-selectin is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity; Authors - Zilong Zhang
rat	WB	Acta Biomater; Rescuing ischemic stroke by biomimetic nanovesicles through accelerated thrombolysis and sequential ischemia-reperfusion protection.; Authors - Wenyan Yu
mouse	WB	ACS Appl Mater Interfaces; Dual-Regulated Biomimetic Nanocomposites For Promoted Tumor Photodynamic Immunotherapy; Authors - Li Liao
mouse	WB	Front Oncol; Platelet Membranes Coated Gold Nanocages for Tumor Targeted Drug Delivery and Amplificated Low-Dose Radiotherapy.; Authors - Mingzhu Chen
human	WB	Front Oncol; An Essential NRP1-Mediated Role for Tagln2 in Gastric Cancer Angiogenesis.; Authors - Hongwei Jin
human	FC	Commun Biol; Generation and characterization of cardiac valve endothelial-like cells from human pluripotent stem cells.; Authors - LinXi Cheng