P-selectin/CD62P Monoclonal antibody

• Home
• Products
• Primary Antibodies
• P-selectin/CD62P Monoclonal antibody (60322-1-Ig)

P-selectin/CD62P Monoclonal Antibody for WB, IP, ELISA

Cat No. 60322-1-Ig Copied!

Clone No. 3G2C7

Publications (48)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IF, IP, ELISA

Synonyms

P-selectin / CD62P, CD62P, P-selectin, 3G2C7, AK4

• 

  WB analysis using 60322-1-Ig

  Untreated and PNGase F-treated lysates of human platelets were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human peripheral blood platelets using 60322-1-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 60322-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60322-1-Ig (P-selectin / CD62P antibody at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 60322-1-Ig

  IP result of anti-P-selectin / CD62P (IP:60322-1-Ig, 5ug; Detection:60322-1-Ig 1:600) with K-562 cells lysate 1760ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for P-selectin/CD62P in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets, Jurkat cells
• Positive IP detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60322-1-Ig targets P-selectin/CD62P in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4124

  Product name: Recombinant human SELP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 441-789 aa of BC028067

  Sequence: VCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQDDGKCPLNPHSHLGTYGVFTNAAFDPSP

• Full Name: selectin P (granule membrane protein 140kDa, antigen CD62)
• Calculated Molecular Weight: 830 aa, 91 kDa
• Observed Molecular Weight: 140 kDa, 105-110 kDa
• GenBank Accession Number: BC028067
• Gene Symbol: CD62P
• Gene ID (NCBI): 6403
• RRID: AB_2881433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P-selectin, also known as GMP140 or CD62P, is a transmembrane glycoprotein that mediates the interaction of activated endothelial cells or platelets with leukocytes. It is an adhesion molecule involved in the pathogenesis of inflammation, thrombosis, and oncogenesis. P-selectin is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.

Publications

What published studies show

The P-selectin/CD62P Monoclonal antibody (3G2C7), catalog number 60322-1-Ig, has 48 total citations. These appear in journals including Cell Metabolism, Science Advances, Advanced Science, ACS Applied Materials & Interfaces, Acta Biomaterialia, Journal of Controlled Release, International Journal of Biological Macromolecules, Biomaterials Advances, and iScience, among others. Research fields span platelet biology and thrombosis, biomimetic nanomedicine for cancer therapy, cardiovascular disease (stroke, myocardial infarction), inflammation (ulcerative colitis, asthma), and tissue repair.

Automatically generated from the 48 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity; Authors - Zilong Zhang
mouse	WB	Exploration (Beijing); Photodynamic Biomimetic Nanoparticles Accelerate Tumor Vascular Normalization Initiation.; Authors - Yufei Liu
mouse	WB	Sci Bull (Beijing); Engineered platelets-based nano-aircraft system for precise tumor chemo-immunotherapy with graded drug delivery and self-recognized tumor targeting; Authors - Meijuan Geng
human	WB	Adv Sci (Weinh); Remodeling Collagen Microenvironment in Liver Using a Biomimetic Nano-Regulator for Reversal of Liver Fibrosis; Authors - Yan Liang
mouse	WB	Sci Adv; Platelet-derived vesicles restore fertility in endometrial injury by modulating the endometrial immune niche in mice.; Authors - Dongxiao Li
mouse	WB	J Control Release; Platelet-mimetic nano-sensor for combating postoperative recurrence and wound infection of triple-negative breast cancer; Authors - Yufei Liu