SELT Polyclonal antibody

SELT Polyclonal Antibody for WB, ELISA

Cat No. 33518-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

EC:1.8.1.9, SELENOT, Thioredoxin reductase-like selenoprotein T, UNQ150/PRO176

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis using 33518-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 33518-1-AP (SELT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

BxPC-3 cells, MCF-7 cells, Ramos cells

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

33518-1-AP targets SELT in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag38727 Product name: Recombinant human SELT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-195 aa of BC008411 Sequence: FGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS Predict reactive species
Full Name	selenoprotein T
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	18 kDa
GenBank Accession Number	BC008411
Gene Symbol	SELT
Gene ID (NCBI)	51714
RRID	AB_3742999
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	P62341
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for SELT antibody 33518-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human, mouse	WB	Free Radic Biol Med Selenium nanoparticles alleviate ulcerative colitis by regulating macrophage mitochondrial dynamics. Authors - Jiajing Chang View Article