Semaphorin 3A Polyclonal antibody

• 

SEMA3A Polyclonal Antibody for IF, IHC, ELISA

Cat No. 21925-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

coll 1, Hsema I, Hsema III, Sema III, SEMA1, SEMA3A, SEMAD, SEMAIII, SEMAL, Semaphorin 3A, Semaphorin III, SemD

---

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

21925-1-AP targets SEMA3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16477

  Product name: Recombinant human SEMA3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 551-771 aa of BC111416

  Sequence: RRTRRQDIRNGDPLTHCSDLHHDNHHGHSPEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV

• Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
• Calculated Molecular Weight: 771 aa, 89 kDa
• GenBank Accession Number: BC111416
• Gene Symbol: SEMA3A
• Gene ID (NCBI): 10371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14563
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	PLoS One; Semaphorin3A induces nerve regeneration in the adult cornea-a switch from its repulsive role in development.; Authors - Min Zhang
mouse	IF	Exp Eye Res; Expression of axon guidance ligands and their receptors in the cornea and trigeminal ganglia and their recovery after corneal epithelium injury.; Authors - Victor H Guaiquil
human	WB	Int Immunopharmacol; Hypoxia-induced Semaphorin 3A promotes the development of endometriosis through regulating macrophage polarization; Authors - Ruyu Yang