SEMA3C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SEMA3C Polyclonal antibody (30638-1-AP)

• 

  IHC staining of mouse pancreas using 30638-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 30638-1-AP (SEMA3C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SEMA3C Polyclonal Antibody for IHC, ELISA

Cat No. 30638-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Sema E, SEMAE, Semaphorin 3C, Semaphorin E, Semaphorin-3C

---

Tested Applications

• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30638-1-AP targets SEMA3C in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32426

  Product name: Recombinant human SEMA3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 560-751 aa of BC030690

  Sequence: PLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES

• Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C
• Calculated Molecular Weight: 85 kDa
• GenBank Accession Number: BC030690
• Gene Symbol: SEMA3C
• Gene ID (NCBI): 10512
• RRID: AB_3742361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99985
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEMA3C (Semaphorin 3C) is associated with tumor progression and poor prognosis across multiple tumor types, including pancreatic, gastric, prostate, and breast cancer, as well as glioma. It is worth noting that full-length SEMA3C has also been reported as a tumor suppressor factor by suppressing tumor lymphangiogenesis and metastasis (PMID: 31649890).