Product Information
67397-3-PBS targets SEMA7A as part of a matched antibody pair:
MP50321-1: 67397-2-PBS capture and 67397-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28804 Product name: Recombinant human SEMA7A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 371-423 aa of BC101643 Sequence: QPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGET Predict reactive species |
| Full Name | semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Calculated Molecular Weight | 666 aa, 75 kDa |
| GenBank Accession Number | BC101643 |
| Gene Symbol | SEMA7A |
| Gene ID (NCBI) | 8482 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O75326 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
