SENP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SENP2 Polyclonal antibody, PBS Only (29772-1-PBS)

• 

  WB analysis using 29772-1-AP (same clone as 29772-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29772-1-AP (SENP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29772-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 29772-1-AP (same clone as 29772-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 29772-1-AP (SENP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29772-1-PBS in a different storage buffer formulation.

SENP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29772-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29772-1-PBS targets SENP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30728

  Product name: Recombinant human SENP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-228 aa of NM_021627

  Sequence: TKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGH

• Full Name: SUMO1/sentrin/SMT3 specific peptidase 2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 60-68 kDa
• GenBank Accession Number: NM_021627
• Gene Symbol: SENP2
• Gene ID (NCBI): 59343
• RRID: AB_3086158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC62
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SENP2 (Sentrin-specific protease 2), as a protease, catalyzes two essential functions in the SUMO pathway. The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins (PMID:15296745). The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein (PMID:20194620, PMID:21965678). It has 2 isoforms with the molecular weight of 66 and 68 kDa.