SENP8 Polyclonal antibody

SENP8 Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 13479-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

HsT17512, FKSG8, EC:3.4.22.-, Deneddylase-1, Deneddylase 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inrat kidney tissue, human liver tissue, human colon cancer tissue, human kidney tissue, human stomach cancer tissue, mouse pancreas tissue, rat pancreas tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13479-1-AP targets SENP8 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4287

Product name: Recombinant human SENP8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-212 aa of BC031411

Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK

Predict reactive species
Full Name SUMO/sentrin specific peptidase family member 8
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight24-28 kDa
GenBank Accession NumberBC031411
Gene Symbol SENP8
Gene ID (NCBI) 123228
RRIDAB_3085415
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96LD8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SENP8, a human NEDD8-specific protease, also known as NEDP1. It is expected to be located in cytoplasm and nucleus, which is highly expressed in kidney and pancreas. The calculated molecular weight of SENP8 is 24 kDa. It is a protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53 (PMID: 15242646). A single-residue difference in the C-terminus of NEDD8 and ubiquitin contributes significantly to the ability of NEDP1 to discriminate between them. In vivo analysis indicates that NEDP1 mutants perturb deNEDDylation of the tumour suppressor p53 (PMID: 12759363).

Protocols

Product Specific Protocols
IHC protocol for SENP8 antibody 13479-1-APDownload protocol
IF protocol for SENP8 antibody 13479-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...