Septin 14 Polyclonal antibody

• 

  WB analysis of rat testis using 24590-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 24590-1-AP (Septin 14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 24590-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24590-1-AP (Septin 14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Septin 14 Polyclonal Antibody for WB, ELISA

Cat No. 24590-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

SEPT14, septin 14, Septin14

---

Tested Applications

• Positive WB detected in: rat testis tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

24590-1-AP targets Septin 14 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20181

  Product name: Recombinant human SEPT14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 389-432 aa of BC153166

  Sequence: IRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK

• Full Name: septin 14
• Calculated Molecular Weight: 432 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC153166
• Gene Symbol: Septin 14
• Gene ID (NCBI): 346288
• RRID: AB_2879626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZU15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Biomedicines; ACTN4 Mediates SEPT14 Mutation-Induced Sperm Head Defects.; Authors - Yu-Hua Lin
mouse	WB	Cell Death Dis; TMEM232 is required for the formation of sperm flagellum and male fertility in mice; Authors - Xinying Cai