Septin 14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Septin 14 Polyclonal antibody (24590-1-AP)

Septin 14 Polyclonal Antibody for WB, ELISA

Cat No. 24590-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

SEPT14, septin 14, Septin14

• 

  WB analysis of rat testis using 24590-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 24590-1-AP (Septin 14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 24590-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24590-1-AP (Septin 14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Septin 14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat testis tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24590-1-AP targets Septin 14 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20181

  Product name: Recombinant human SEPT14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 389-432 aa of BC153166

  Sequence: IRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK

• Full Name: septin 14
• Calculated Molecular Weight: 432 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC153166
• Gene Symbol: Septin 14
• Gene ID (NCBI): 346288
• RRID: AB_2879626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZU15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Septin 14 (SEPT14) polyclonal antibody (Cat# 24590-1-AP) has a total of 3 citations. These appear in Cell Death & Disease, Ecotoxicology and Environmental Safety, and Biomedicines. The associated research fields include reproductive biology (sperm flagellum formation and head shaping), environmental toxicology (PFOA exposure effects on sperm), and genetic studies of SEPT14 mutation-induced sperm defects. Applications cited include WB and IF in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Death Dis; TMEM232 is required for the formation of sperm flagellum and male fertility in mice; Authors - Xinying Cai
mouse	WB	Ecotoxicol Environ Saf; PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice.; Authors - Chuan Wang
human	IF	Biomedicines; ACTN4 Mediates SEPT14 Mutation-Induced Sperm Head Defects.; Authors - Yu-Hua Lin