Septin 7 Monoclonal antibody

• 

  WB analysis using 66542-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66542-1-Ig (Septin 7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 66542-1-Ig

  WB result of Septin 7 antibody (66542-1-Ig; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-Septin 7 transfected HepG2 cells.

• 

  IHC staining of human gliomas using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66542-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66542-1-Ig (Septin 7 antibody) at dilution of 1:1000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Septin 7 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66542-1-Ig

Clone No.1G12D1

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

septin7, 1G12D1, CDC10, CDC10 protein homolog, CDC3

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 tissue
• Positive IHC detected in: human gliomas tissue, human lung tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

66542-1-Ig targets Septin 7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4309

  Product name: Recombinant human SEPT7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 110-417 aa of BC025987

  Sequence: VIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF

• Full Name: septin 7
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 48-51 kDa
• GenBank Accession Number: BC025987
• Gene Symbol: Septin 7
• Gene ID (NCBI): 989
• RRID: AB_2881904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16181
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Septins (SEPTs) are members of a conserved family of cytoskeletal GTPases involved in various cellular processes, including cytoskeleton organization, cytokinesis, and membrane dynamics. Septin 7 is a unique septin required for filament formation. It has also been reported to be involved in migration and invasion in various cancer cells, including breast cancer and glioma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell Int; The clustering status of detached gastric cancer cells inhibits anoikis-induced ferroptosis to promote metastatic colonization; Authors - Juan Sun
rat,mouse,human	WB,IF	J Adv Res; Pharmacological inhibition of Septins with Forchlorfenuron attenuates thrombus formation in experimental thrombotic mice models with modulating multiple signaling pathways in platelets; Authors - Zhen Hao