Septin 8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Septin 8 Polyclonal antibody (11769-1-AP)

• Featured Product
• KD/KO Validated

Septin 8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11769-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SEPT8, Septin-8, SEPTIN8, SEP2, KIAA0202

• 

  WB analysis of HeLa using 11769-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11769-1-AP (Septin 8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 11769-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 11769-1-AP (Septin 8 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 11769-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11769-1-AP (Septin 8 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 11769-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11769-1-AP (Septin 8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 11769-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11769-1-AP (Septin 8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11769-1-AP

  IP result of anti-Septin 8 (IP:11769-1-AP, 3ug; Detection:11769-1-AP 1:1000) with HeLa cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11769-1-AP (Septin 8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11769-1-AP (SEPT8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11769-1-AP (Septin 8 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11769-1-AP (SEPT8 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11769-1-AP (Septin 8 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11769-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11769-1-AP (SEPT8 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of hTERT-RPE1 using 11769-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using Septin 8 antibody (11769-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Septin 8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, K-562 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human gliomas tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11769-1-AP targets Septin 8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2357

  Product name: Recombinant human SEPT8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-256 aa of BC001329

  Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK

• Full Name: septin 8
• Calculated Molecular Weight: 55.6 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC001329
• Gene Symbol: Septin 8
• Gene ID (NCBI): 23176
• RRID: AB_2185006
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92599
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Septin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are 40-60kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking. It may play a role in platelet secretion. Septin 8 is about 50-56 kDa in WB detection.

Publications

What published studies show

SEPT8 antibody (Cat# 11769-1-AP) has 13 total citations across 9 journals: Journal of Advanced Research, Cells, Glia, Thrombosis and Haemostasis, Development, Journal of Cell Science, Journal of Huntington's Disease, Cytoskeleton, and eLife. Research fields include CNS myelination and myelin integrity, platelet function and thrombosis, septin cytoskeleton biology, Huntington's disease, kidney fibrosis, and APP amyloidogenic processing.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse,rat	WB	J Adv Res; Pharmacological inhibition of Septins with Forchlorfenuron attenuates thrombus formation in experimental thrombotic mice models with modulating multiple signaling pathways in platelets; Authors - Zhen Hao
human	WB	Cells; A Septin Cytoskeleton-Targeting Small Molecule, Forchlorfenuron, Inhibits Epithelial Migration via Septin-Independent Perturbation of Cellular Signaling.; Authors - Lei Sun
mouse	WB	Glia; Developmental maturation and regional heterogeneity but no sexual dimorphism of the murine CNS myelin proteome; Authors - Sophie B Siems
		Glia; The formation of paranodal spirals at the ends of CNS myelin sheaths requires the planar polarity protein Vangl2.; Authors - Andrew A Jarjour
mouse	WB,IF	Glia; CDC42-Effector Proteins Regulate Higher Order Structure of Septins Required for CNS Myelin Integrity.; Authors - Sophie Hümmert
mouse	WB,IF	Thromb Haemost; Impaired Platelet Function in Sept8-Deficient Mice In Vitro; Authors - Katharina Neubauer