SERINC5 Polyclonal antibody

• 

  WB analysis of human placenta using 27066-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27066-1-AP (SERINC5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 27066-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 27066-1-AP (SERINC5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human oesophagus cancer using 27066-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 27066-1-AP (SERINC5 antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SERINC5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27066-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C5orf12, SERINC5, serine incorporator 5, TPO1

---

Tested Applications

• Positive WB detected in: human placenta tissue, human spleen tissue
• Positive IHC detected in: human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

27066-1-AP targets SERINC5 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25265

  Product name: Recombinant human SERINC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC101280

  Sequence: MSAQCCAGQLACCCGSAGCSLCCDCCPRIRQSLSTRFMYALYFILVVVLCCIMMSTTVAHKMKEHIPFFEDMCKGIKAGDTCEKLVGYS

• Full Name: serine incorporator 5
• Calculated Molecular Weight: 423 aa, 47 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC101280
• Gene Symbol: SERINC5
• Gene ID (NCBI): 256987
• RRID: AB_2880739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VE9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Neurobiol; Exosomes Derived from Meningitic Escherichia coli-Infected Brain Microvascular Endothelial Cells Facilitate Astrocyte Activation; Authors - Ruicheng Yang
human	WB	Front Microbiol; SERINC5 Inhibits the Secretion of Complete and Genome-Free Hepatitis B Virions Through Interfering With the Glycosylation of the HBV Envelope.; Authors - Yue Liu ; KD Validated