Use Able AI chat for product recommendations

Serpin A5/Protein C Inhibitor Polyclonal antibody

Serpin A5/Protein C Inhibitor Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Serpin A5, PAI3, PCI, PLANH3, Plasma serine protease inhibitor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Serpin A5/Protein C Inhibitor in ?

Tested Applications

Positive WB detected inHeLa cells, A549 cells, Jurkat cells, L02 cells, PC-3 cells, HepG2 cells
Positive IHC detected inhuman ovary tumor tissue, human breast cancer tissue, human ovary cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10673-1-AP targets Serpin A5/Protein C Inhibitor in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1078

Product name: Recombinant human SERPINA5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 106-406 aa of BC008915

Sequence: ELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC008915
Gene Symbol SERPINA5
Gene ID (NCBI) 5104
RRIDAB_2185741
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05154
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA5 (also called Protein C Inhibitor, PCI ) is a serpin type of serine protease inhibitor that is found in many tissues and fluids in human, including blood plasma, seminal plasma and urine. PCI found in blood originates from the liver and is capable of inhibiting several serine proteases involved in the regulation of coagulation and fibrinolysis, including activated protein C, thrombin, factor Xa, various kallikreins and plasminogen activators. PCI has been found to have antimicrobial and antitumor properties and thus appears to be a multi-functional protein.

Protocols

Product Specific Protocols
IF protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-APDownload protocol
IHC protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-APDownload protocol
WB protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Serpin A5/Protein C Inhibitor polyclonal antibody (Cat# 10673-1-AP) has 6 total citations published across six journals: Modern Pathology, Biomolecules, Journal of Cellular and Molecular Medicine, Journal of Proteome Research, Journal of Neuropathology & Experimental Neurology, and Proteomics Clinical Applications. Research fields include ovarian tumor progression, preeclampsia, gastric cancer signaling, osteoarthritis proteomics, and pilocytic astrocytoma biomarker identification.

SpeciesApplicationTitle
humanIHC

Mod Pathol

Loss of SerpinA5 protein expression is associated with advanced-stage serous ovarian tumors.

Authors - Bijsmans Ingrid T G W IT
ratIHC,ELISA

Biomolecules

Improvement in Clinical Features of L-NAME-Induced Preeclampsia-like Rats through Reduced SERPINA5 Expression

Authors - Shanshui Zeng
humanWB,CoIP

J Cell Mol Med

SERPINA5 promotes tumour cell proliferation by modulating the PI3K/AKT/mTOR signalling pathway in gastric cancer

Authors - Meiyang Fan
rat,humanIHC

J Proteome Res

Proteomics Analysis of Knee Subchondral Bone Identifies Differentially Expressed Proteins Associated with Osteoarthritis

Authors - Qizhao Tan
humanIHC

J Neuropathol Exp Neurol

Gene expression profiling of NF-1-associated and sporadic pilocytic astrocytoma identifies aldehyde dehydrogenase 1 family member L1 (ALDH1L1) as an underexpressed candidate biomarker in aggressive subtypes.

Authors - Rodriguez Fausto J FJ
ratIHC

Proteomics Clin Appl

Proteomic analysis of human articular cartilage unravels the dyscoagulation in osteoarthritis and the potential value of serpinA5 as a biomarker for osteoarthritis.

Authors - Tengjiao Zhu
Loading...
||
New chat

Able™

正在加载,请稍候...