SERPINB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SERPINB1 Polyclonal antibody, PBS Only (33756-1-PBS)

• 

  WB analysis using 33756-1-AP (same clone as 33756-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33756-1-AP (SERPINB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33756-1-PBS in a different storage buffer formulation.

SERPINB1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33756-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EI, ELANH2, LEI, Leukocyte elastase inhibitor, M/NEI

---

Product Information

33756-1-PBS targets SERPINB1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35798

  Product name: Recombinant human SERPINB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 169-318 aa of NM_030666.3

  Sequence: GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKI

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 1
• Calculated Molecular Weight: 43kDa，379aa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: NM_030666.3
• Gene Symbol: SERPINB1
• Gene ID (NCBI): 1992
• RRID: AB_3743069
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P30740
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SERPINB1, also called Leukocyte Elastase Inhibitor (LEI) is a member of the clade B of SERPINS. It is an intracellular protein and acts primarily to protect the cell from proteases released into the cytoplasm during stress.