SERPINB7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SERPINB7 Polyclonal antibody (21170-1-AP)

• 

  WB analysis using 21170-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21170-1-AP (SERPINB7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21170-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21170-1-AP (SERPINB7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

SERPINB7 Polyclonal Antibody for WB, ELISA

Cat No. 21170-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Serpin B7, MEGSIN, TP55

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse liver tissue, rat liver tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21170-1-AP targets SERPINB7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15394

  Product name: Recombinant human SERPINB7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-305 aa of BC069417

  Sequence: SLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKA

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 7
• Calculated Molecular Weight: 380 aa, 43 kDa
• Observed Molecular Weight: 43-45 kDa
• GenBank Accession Number: BC069417
• Gene Symbol: SERPINB7
• Gene ID (NCBI): 8710
• RRID: AB_3742020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75635
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serine protease inhibitor B7 (SERPINB7) is also named Serpin B7, Megsin and TP55. SerpinB7 is identified as a skin-specific endogenous protease inhibitor. SerpinB7 is upregulated in diabetic nephropathy and induces progressive mesangial expansion (PMID: 11877466). SERPINB7 is abundantly expressed in keratinocytes, with particularly high levels in the stratum corneum and stratum granulosum of the epidermis (PMID: 41469525). SERPINB7 promotes keratinocyte differentiation and dampens inflammation in psoriasis in a calcium-dependent manner (PMID: 35864103). SERPINB7 is expressed mostly in renal mesangial cells, and its expression is significantly increased in renal tissues of IgA and diabetic nephropathies. SERPINB7 regulates cell proliferation, signal transduction, and extracellular matrix metabolism (PMID: 37809412).