SERPINB9 Polyclonal antibody

• 

  WB analysis using 14910-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14910-1-AP (SERPINB9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SERPINB9 Polyclonal Antibody for WB, ELISA

Cat No. 14910-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CAP 3, CAP3, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI 9, PI9, Serpin B9, SERPINB9

---

Tested Applications

• Positive WB detected in: K-562 cells, Human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

14910-1-AP targets SERPINB9 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6707

  Product name: Recombinant human SERPINB9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC002538

  Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 9
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002538
• Gene Symbol: SERPINB9
• Gene ID (NCBI): 5272
• RRID: AB_2254462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINB9, also named as PI-9, belongs to the serpin family. SERPINB9 is an intracellular inhibitor of granzyme B (grB) that protects cytotoxic lymphocytes from grB-mediated death. It has a nucleo-cytoplasmic distribution and is produced in CD8+ T cells and natural killer cells (PMID: 28024184). Also, SERPINB9 is expressed by vascular SMCs and endothelial cells to avoid GZB-induced apoptosis (PMID: 28743062). The molecular weight of SERPINB9 is 42 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Inflamm Res; Serpin B9 is Highly Expressed in Lung Adenocarcinoma and is Associated with Progression-Free Survival; Authors - Yue Fang