Sestrin 2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Sestrin 2 Polyclonal antibody (21346-1-AP)

• Featured Product
• KD/KO Validated

Sestrin 2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21346-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

SESN2, Sestrin2, EC:1.11.1.-, Hi95, Hypoxia-induced gene

• 

  WB analysis of mouse thymus using 21346-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 21346-1-AP (Sestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 21346-1-AP

  WB result of Sestrin 2 antibody (21346-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Sestrin 2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 21346-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21346-1-AP (Sestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21346-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21346-1-AP (Sestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 21346-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21346-1-AP (Sestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 21346-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21346-1-AP (Sestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 21346-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using Sestrin 2 antibody (21346-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Sestrin 2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, HEK-293 cells, HeLa cells, K-562 cells, mouse lung tissue, NIH/3T3 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21346-1-AP targets Sestrin 2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15669

  Product name: Recombinant human SESN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of NM_031459

  Sequence: MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI

• Full Name: sestrin 2
• Calculated Molecular Weight: 480 aa, 54 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: NM_031459
• Gene Symbol: SESN2/Sestrin 2
• Gene ID (NCBI): 83667
• RRID: AB_10733238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell growth and survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).

Publications

What published studies show

The Sestrin2 antibody (Cat# 21346-1-AP) has 16 citations across journals including Cancer Cell, Phytomedicine, Journal of Investigative Dermatology, Frontiers in Immunology, Cells, Neurobiology of Disease, International Journal of Molecular Sciences, Journal of Cerebral Blood Flow & Metabolism, Journal of Neurochemistry, Molecular and Cellular Biology, and eLife. Research fields span oncology (melanoma, rhabdoid tumors), neuroscience (neuroprotection, Alzheimer's, neuroinflammation), cardiovascular disease, metabolism (mTOR/AMPK signaling), and autophagy.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; p53 Is a Master Regulator of Proteostasis in SMARCB1-Deficient Malignant Rhabdoid Tumors.; Authors - Alessandro Carugo
human, mouse	WB,IF	Phytomedicine; Rhoifolin prevents herpes simplex virus encephalitis by modulating SESN2 to regulate the Keap1/Nrf2 and AMPK/Nox pathways to inhibit neuro-oxidative damage in mice.; Authors - Wenhui Yang
human	WB,IF	J Invest Dermatol; Metastatic melanoma cells rely on Sestrin2 to acquire anoikis resistance via detoxifying intracellular ROS.; Authors - Guannan Zhu ; KD Validated
mouse	WB,IF	Front Immunol; Sestrin2 provides cerebral protection through activation of Nrf2 signaling in microglia following subarachnoid hemorrhage; Authors - Youqing Yang
rat	IF	Neurobiol Dis; Sestrin2 induced by hypoxia inducible factor1 alpha protects the blood-brain barrier via inhibiting VEGF after severe hypoxic-ischemic injury in neonatal rats.; Authors - Xudan Shi
mouse	WB	Cells; Sestrin2 Mediates Metformin Rescued the Age-Related Cardiac Dysfunctions of Cardiorenal Syndrome Type 3; Authors - Migdalia Iglesias