SETD4 Polyclonal antibody

• 

  WB analysis using 30855-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30855-1-AP (SETD4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

SETD4 Polyclonal Antibody for WB, ELISA

Cat No. 30855-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C21orf18, C21orf27, SET domain containing 4, SETD 4

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MG-63 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30855-1-AP targets SETD4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33842

  Product name: Recombinant human SETD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC002898

  Sequence: MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNL

• Full Name: SET domain containing 4
• Calculated Molecular Weight: 440 aa, 50 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC002898
• Gene Symbol: SETD4
• Gene ID (NCBI): 54093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NVD3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.