SETD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SETD4 Polyclonal antibody (30855-1-AP)

• 

  WB analysis using 30855-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30855-1-AP (SETD4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

SETD4 Polyclonal Antibody for WB, ELISA

Cat No. 30855-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C21orf18, C21orf27, SET domain containing 4, SETD 4

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MG-63 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30855-1-AP targets SETD4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33842

  Product name: Recombinant human SETD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC002898

  Sequence: MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNL

• Full Name: SET domain containing 4
• Calculated Molecular Weight: 440 aa, 50 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC002898
• Gene Symbol: SETD4
• Gene ID (NCBI): 54093
• RRID: AB_3742378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NVD3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

As a lysine methyl-transferase of histone, SET domain-containing protein 4 (SETD4) has been reported to play a role in cell proliferation by controlling related gene expressions . Limited reports reveal that SETD4 is not only indispensable for embryonic neurogenesis, development and regeneration of pancreatic and intestinal organs, regulation of bone marrow mesenchymal stem cells, and modulation of inflammatory cytokines of macrophages, but also involved in the tumorigenesis, progression, and chemotherapy resistance of various tumors, including liver cancer, breast cancer, lymphoma and Non-small Cell Lung Cancer. (PMID: 35545041, PMID: 36027907, PMID: 37879429)