SF3B4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SF3B4 Polyclonal antibody (10482-1-AP)

• Featured Product
• KD/KO Validated

SF3B4 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10482-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

SAP 49, SAP49, SF3B4, SF3b49, SF3b50, Splicing factor 3B subunit 4

• 

  WB analysis of HEK-293T using 10482-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 10482-1-AP (SF3B4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 10482-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 10482-1-AP (SF3B4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10482-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10482-1-AP (SF3B4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 10482-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10482-1-AP (SF3B4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10482-1-AP

  IP result of anti-SF3B4 (IP:10482-1-AP, 4ug; Detection:10482-1-AP 1:500) with HeLa cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 10482-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10482-1-AP (SF3B4 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SF3B4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HEK-293 cells, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10482-1-AP targets SF3B4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0737

  Product name: Recombinant human SF3B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004273

  Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

• Full Name: splicing factor 3b, subunit 4, 49kDa
• Calculated Molecular Weight: 44 aa, 3 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC004273
• Gene Symbol: SF3B4
• Gene ID (NCBI): 10262
• RRID: AB_2301639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15427
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SF3B4, also named as Pre-mRNA-splicing factor SF3b 49 kDa subunit, is a 424 amino acid protein, which belongs to the SF3B4 family. SF3B4 is a subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. The calculated molecular weight of SF3B4 is 44 kDa. Based on its predicted molecular mass and the observed migration of the 50kDa cross-linked species on two-dimensional gels.(PMID: 9614130)

Publications

What published studies show

The SF3B4 Polyclonal antibody (Cat# 10482-1-AP) has accumulated 23 citations across journals including Nature Communications, Cell Death & Disease, Signal Transduction and Targeted Therapy, PLoS Genetics, iScience, Journal of Translational Medicine, Clinical and Translational Medicine, Cancer Gene Therapy, and more. Associated research fields include oncology (renal, ovarian, cervical, hepatocellular, lung, colorectal, and nasopharyngeal cancers), RNA splicing regulation, stem cell biology, neurodevelopment, cardiomyocyte hypertrophy, and proteomics.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Signal Transduct Target Ther; Region-resolved proteomic map of the human brain: functional interconnections and neurological implications; Authors - Pei-Pei Zhang
human	IF	Nat Commun; Spliceosome induction is a druggable dependency of RAS-driven senescence and cancer.; Authors - Verena Wagner
human	WB,IHC,IF,IP	Cell Death Dis; SF3B4 promotes Twist1 expression and clear cell renal cell carcinoma progression by facilitating the export of KLF 16 mRNA from the nucleus to the cytoplasm; Authors - Zhan Yang ; KD Validated
human	WB,IHC	Cell Death Dis; SF3B4 promotes ovarian cancer progression by regulating alternative splicing of RAD52.; Authors - Yuchao Diao ; KD Validated
human	WB,IHC	Cell Death Discov; The splicing factor SF3B4 drives proliferation and invasion in cervical cancer by regulating SPAG5; Authors - Yingwei Li ; KD Validated
human	CoIP	J Transl Med; SF3B4 regulates proliferation and apoptosis in hepatocellular carcinoma via alternative splicing and interaction with TRIM28 and SETD5; Authors - HanFei Huang