SFR1 Polyclonal antibody

• 

  WB analysis of Jurkat using 26284-1-AP

  WB result of C10orf78 antibody (26284-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C10orf78 transfected Jurkat cells.

• 

  WB analysis using 26284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26284-1-AP (C10orf78 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

SFR1 Polyclonal Antibody for WB, ELISA

Cat No. 26284-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C10orf78, MEI5, Meiosis protein 5 homolog, MEIR5, SWI5 Dependent Homologous Recombination Repair Protein 1

---

Tested Applications

• Positive WB detected in: HL-60 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26284-1-AP targets SFR1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23332

  Product name: Recombinant human C10orf78 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-232 aa of BC140835

  Sequence: MESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV

• Full Name: chromosome 10 open reading frame 78
• Observed Molecular Weight: 35, 36 kDa
• GenBank Accession Number: BC140835
• Gene Symbol: C10orf78
• Gene ID (NCBI): 119392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SFR1 protein was initially discovered in the context of DNA homologous recombination repair, and its name originates from "Swi6-interacting recombination repair protein 1." However, subsequent research has revealed its central role in the field of cell death, particularly in the process of **necroptosis**. In the classical necroptosis signaling pathway, when cells receive death signals such as tumor necrosis factor, SFR1 is recruited and phosphorylated by the upstream kinase RIPK3 as a key adaptor protein. Phosphorylated SFR1 specifically binds to and stabilizes MLKL, the core executioner protein of necroptosis, significantly promoting the phosphorylation and subsequent activation of MLKL by RIPK3. This process ultimately leads to plasma membrane rupture and inflammatory cell death. Therefore, SFR1 is considered a critical molecule that precisely regulates the amplification and execution of necroptosis signaling. The study of its function is of great importance for understanding pathological processes such as infections, inflammatory diseases, and tissue damage.