Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IHC detected in | mouse kidney tissue, human cervical cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17926-1-AP targets SFRS9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12347 Product name: Recombinant human SFRS9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC093973 Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY Predict reactive species |
| Full Name | splicing factor, arginine/serine-rich 9 |
| Calculated Molecular Weight | 221 aa, 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC093973 |
| Gene Symbol | SFRS9 |
| Gene ID (NCBI) | 8683 |
| RRID | AB_2270087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13242 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRS9 is a member of the serine/arginine (SR) splicing factor family, which contains an N-terminal RNA recognition motif (RRM), a glycine-rich region, an internal region homologous to the RRM, and a long (315-amino-acid) C-terminal domain composed predominantly of alternating serine and arginine residues. SRSF9 has been linked to the occurrence and progression of hepatocellular carcinoma (HCC), colorectal cancer (CRC) and oral squamous cell carcinoma (OSCC). In HCC and CRC, the knockdown of SRSF9 inhibited the proliferation and migration of cancer cells, cell cycle progression and colony formation of cancer cells (PMID: 34336668,35971121).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SFRS9 antibody 17926-1-AP | Download protocol |
| WB protocol for SFRS9 antibody 17926-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SFRS9 Polyclonal antibody (Cat# 17926-1-AP) has 10 citations published in journals including Cancer Research, Nature Communications, Journal of Advanced Research, Nucleic Acids Research, Cell Death & Disease, Science Signaling, Journal of Cell Biology, Journal of Cancer Research and Clinical Oncology, BMC Medical Genomics, and Human Mutation. Research fields span RNA splicing regulation, phase separation, cancer biology (ovarian, oral, gastric, glioblastoma, hepatocellular carcinoma), ferroptosis, stress granules, synaptic plasticity, and genetic disorders.
| Species | Application | Title |
|---|---|---|
Cancer Res SRSF9 Forms Phase-separated Condensates to Promote Ovarian Cancer Progression by Inducing RNA Alternative Splicing that is Inhibited by m6A Modification
| ||
Nat Commun Mutually exclusive acetylation and ubiquitylation of the splicing factor SRSF5 control tumor growth. | ||
J Adv Res SRSF9 mediates oncogenic RNA splicing of SLC37A4 via liquid-liquid phase separation to promote oral cancer progression
| ||
Nucleic Acids Res Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway. | ||
Cell Death Dis Chemotoxicity-induced exosomal lncFERO regulates ferroptosis and stemness in gastric cancer stem cells. | ||
Sci Signal ADAR2-mediated Q/R editing of GluA2 in homeostatic synaptic plasticity
|
Reviews
What customers say
The single review for 17926-1-AP is from a user who performed immunofluorescence on a human cancer cell line at a 1:150 dilution (Lot 00009310). They rated the product 5 out of 5 stars and noted that the staining signal appeared inside the nucleus, indicating clear nuclear localization of the target. Overall, the reviewer was satisfied with the performance and specificity of the antibody for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jingwen (Verified Customer) (04-28-2021) | The staining signal showed up inside the nucleus.
|
