Tested Applications
| Positive WB detected in | A549 cells, Calu-1 cells, HeLa cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32914-1-AP targets SFT2D2 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36996 Product name: Recombinant human SFT2D2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC068098 Sequence: MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLH Predict reactive species |
| Full Name | SFT2 domain containing 2 |
| Calculated Molecular Weight | 160 aa, 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC068098 |
| Gene Symbol | SFT2D2 |
| Gene ID (NCBI) | 375035 |
| RRID | AB_3742784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O95562 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFT2D2 is part of the SFT2 protein family, which is involved in managing membrane traffic inside cells. Its specific molecular role is linked to the Golgi apparatus, a central hub for processing and sorting proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SFT2D2 antibody 32914-1-AP | Download protocol |
| WB protocol for SFT2D2 antibody 32914-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



