Product Information
21145-1-PBS targets SFTA2 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15656 Product name: Recombinant human SFTA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC039677 Sequence: MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVVCNT Predict reactive species |
| Full Name | surfactant associated 2 |
| Calculated Molecular Weight | 78 aa, 8 kDa |
| GenBank Accession Number | BC039677 |
| Gene Symbol | SFTA2 |
| Gene ID (NCBI) | 389376 |
| RRID | AB_3742018 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6UW10 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



