SFTPB Polyclonal antibody

• 

  WB analysis of A549 using 13664-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 13664-1-AP (SFTPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13664-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13664-1-AP (SFTPB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SFTPB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13664-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

SP-B, Pulmonary surfactant-associated proteolipid SPL(Phe), Pulmonary surfactant-associated protein B, 6 kDa protein, 18 kDa pulmonary-surfactant protein

---

Tested Applications

• Positive WB detected in: human lung tissue, A549 cells
• Positive IHC detected in: human lung cancer tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

13664-1-AP targets SFTPB in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4576

  Product name: Recombinant human SFTPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC032785

  Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

• Full Name: surfactant protein B
• Calculated Molecular Weight: 381 aa, 42 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC032785
• Gene Symbol: SFTPB
• Gene ID (NCBI): 6439
• RRID: AB_2185487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07988
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pulmonary surfactant-associated protein B(SFTPB) also named SFTP3, is a hydrophobic peptide that facilitates the formation and maintenance of a phospholipid-rich film at the alveolar air-liquid interface. SP-B is necessary for postnatal lung function. SFTPB as a risk biomarker for lung cancer. (PMID:36460583).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	Exp Hematol Oncol; Downregulation of pro-surfactant protein B contributes to the recurrence of early-stage non-small cell lung cancer by activating PGK1-mediated Akt signaling; Authors - Hao Luo ; KD Validated
mouse	WB	Int J Mol Sci; Kub3 Deficiency Causes Aberrant Late Embryonic Lung Development in Mice by the FGF Signaling Pathway.; Authors - Guangying Yang
human	WB,IHC,IF	Lab Invest; Liquid Biopsy in Lung Cancer: Nano-Flow Cytometry Detection of Non-Small Cell Lung Cancer in Blood; Authors - Andong Zhang
human	WB	Environ Toxicol; Silica nanoparticle exposure inhibits surfactant protein A and B in A549 cells through ROS-mediated JNK/c-Jun signaling pathway.; Authors - Xiaojing Yang
human	IHC	Heliyon; Therapeutic and prognostic effect of disulfidptosis-related genes in lung adenocarcinoma; Authors - Changshuan Li
mouse	IHC,IF	Int Immunopharmacol; The impact of POSTN on tumor cell behavior and the tumor microenvironment in lung adenocarcinoma; Authors - Dongfeng Sun