SFTPB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SFTPB Polyclonal antibody (13664-1-AP)

• Featured Product
• KD/KO Validated

SFTPB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13664-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

SP-B, Pulmonary surfactant-associated proteolipid SPL(Phe), Pulmonary surfactant-associated protein B, 6 kDa protein, 18 kDa pulmonary-surfactant protein

• 

  WB analysis of A549 using 13664-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 13664-1-AP (SFTPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13664-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13664-1-AP (SFTPB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 13664-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 13664-1-AP (SFTPB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SFTPB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human lung tissue, A549 cells
• Positive IHC detected in: human lung cancer tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13664-1-AP targets SFTPB in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4576

  Product name: Recombinant human SFTPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC032785

  Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

• Full Name: surfactant protein B
• Calculated Molecular Weight: 381 aa, 42 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC032785
• Gene Symbol: SFTPB
• Gene ID (NCBI): 6439
• RRID: AB_2185487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07988
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pulmonary surfactant-associated protein B(SFTPB) also named SFTP3, is a hydrophobic peptide that facilitates the formation and maintenance of a phospholipid-rich film at the alveolar air-liquid interface. SP-B is necessary for postnatal lung function. SFTPB as a risk biomarker for lung cancer. (PMID:36460583).

Publications

What published studies show

The SFTPB Polyclonal antibody (Cat# 13664-1-AP) has 8 citations published in journals including Experimental Hematology Oncology, Journal of Genetics and Genomics, Journal of Agricultural and Food Chemistry, International Journal of Molecular Sciences, International Immunopharmacology, Laboratory Investigation, Environmental Toxicology, and Heliyon. Research fields span lung cancer, pulmonary lipid homeostasis, blood-testis barrier disruption, embryonic lung development, tumor microenvironment, liquid biopsy, oxidative stress signaling, and disulfidptosis.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	Exp Hematol Oncol; Downregulation of pro-surfactant protein B contributes to the recurrence of early-stage non-small cell lung cancer by activating PGK1-mediated Akt signaling; Authors - Hao Luo ; KD Validated
		J Genet Genomics; Tapt1 deficiency in mice impairs pulmonary lipid homeostasis and normal postnatal respiration by targeting ABCA3 for autophagy-lysosomal degradation.; Authors - Dandan Tan
mouse	WB,IHC	J Agric Food Chem; Curcumin Alleviates Bisphenol A-Induced Blood-Testis Barrier Disruption in Mice by Targeting Surfactant Protein B (SFTPB) to Suppress Oxidative Stress-Activated NLRP3 Inflammasome.; Authors - Hongwei Duan ; KD Validated
mouse	IHC,IF	Int Immunopharmacol; The impact of POSTN on tumor cell behavior and the tumor microenvironment in lung adenocarcinoma; Authors - Dongfeng Sun
mouse	WB	Int J Mol Sci; Kub3 Deficiency Causes Aberrant Late Embryonic Lung Development in Mice by the FGF Signaling Pathway.; Authors - Guangying Yang
human	WB,IHC,IF	Lab Invest; Liquid Biopsy in Lung Cancer: Nano-Flow Cytometry Detection of Non-Small Cell Lung Cancer in Blood; Authors - Andong Zhang