SFTPB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 82866-16-RR (same clone as 82866-16-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 82866-16-RR (SFTPB antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82866-16-PBS in a different storage buffer formulation.

SFTPB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82866-16-PBS

Clone No.230240D4

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

6 kDa protein, PSP B, SFTB3, SFTP3, SFTPB, SMDP1, SP B, surfactant protein B

---

Product Information

82866-16-PBS targets SFTPB in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23605

  Product name: Recombinant human SFTPB protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-381 aa of BC032785

  Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

• Full Name: surfactant protein B
• Calculated Molecular Weight: 381 aa, 42 kDa
• GenBank Accession Number: BC032785
• Gene Symbol: SFTPB
• Gene ID (NCBI): 6439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P07988
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.