SFXN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SFXN1 Polyclonal antibody (12296-1-AP)

• Featured Product
• KD/KO Validated

SFXN1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12296-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

sideroflexin 1, Sideroflexin-1, TCC, Tricarboxylate carrier protein

• 

  WB analysis using 12296-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12296-1-AP (SFXN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 12296-1-AP

  WB result of SFXN1 antibody (12296-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SFXN1 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 12296-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12296-1-AP (SFXN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12296-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12296-1-AP (SFXN1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 12296-1-AP

  IP result of anti-SFXN1 (IP:12296-1-AP, 4ug; Detection:12296-1-AP 1:800) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 12296-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12296-1-AP (SFXN1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 12296-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12296-1-AP (SFXN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12296-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 12296-1-AP (SFXN1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12296-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 12296-1-AP (SFXN1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SFXN1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human brain tissue, mouse liver tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12296-1-AP targets SFXN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2985

  Product name: Recombinant human SFXN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC020517

  Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL

• Full Name: sideroflexin 1
• Calculated Molecular Weight: 35.6 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC020517
• Gene Symbol: SFXN1
• Gene ID (NCBI): 94081
• RRID: AB_2185814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H9B4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs.

Publications

What published studies show

Anti-SFXN1 (catalog #12296-1-AP) has 20 citations across journals including Nature Chemical Biology, Cell Reports, Science of the Total Environment, British Journal of Cancer, Frontiers in Immunology, International Immunopharmacology, Lung Cancer, Scientific Reports, BMC Cancer, Glia, Molecules, IUBMB Life, PLoS One, J Proteome Res, eLife, and bioRxiv. Research fields encompass ferroptosis, ferritinophagy, mitochondrial metabolism, cardiac pathology (diabetic cardiomyopathy, sepsis), and oncology (lung, colon, hepatocellular, and prostate cancers), with applications primarily in Western blot and immunohistochemistry.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers.; Authors - Mariluz Soula ; KO Validated
human	WB	Authors -
rat,mouse	WB,IHC	Sci Total Environ; Ferritinophagy activation and sideroflexin1-dependent mitochondrial iron overload contribute to patulin-induced cardiac inflammation and fibrosis; Authors - Wen-Chang Sun ; KD Validated
		Br J Cancer; Rewiring of de novo serine synthesis supports tumorigenesis under deficiency of TET2.; Authors - Ke Zheng
human	WB	Cell Rep; The mitochondrial carrier SFXN1 is critical for complex III integrity and cellular metabolism.; Authors - Michelle Grace Acoba ; KO Validated
mouse	WB	Front Immunol; YAP1 alleviates sepsis-induced acute lung injury via inhibiting ferritinophagy-mediated ferroptosis; Authors - Jing Zhang