SFXN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SFXN2 Polyclonal antibody, PBS Only (15985-1-PBS)

• 

  IHC staining of human kidney using 15985-1-AP (same clone as 15985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15985-1-AP (SFXN2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15985-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15985-1-AP (same clone as 15985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15985-1-AP (SFXN2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15985-1-PBS in a different storage buffer formulation.

SFXN2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15985-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

15985-1-PBS targets SFXN2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8788

  Product name: Recombinant human SFXN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-224 aa of BC022091

  Sequence: MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYAKKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGFMLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASPTSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLVGRWVPFAAVAAANCVNIPMMRQQELIKGICVKDRNENEIGHSRRAAAIG

• Full Name: sideroflexin 2
• Calculated Molecular Weight: 322 aa, 36 kDa
• GenBank Accession Number: BC022091
• Gene Symbol: SFXN2
• Gene ID (NCBI): 118980
• RRID: AB_2185821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NB2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.