SFXN3 Polyclonal antibody

• 

  WB analysis of HeLa using 15156-1-AP

  WB result of SFXN3 antibody (15156-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SFXN3 transfected HeLa cells.

• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 15156-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of BxPC-3 using 15156-1-AP

  Immunofluorescent analysis of BxPC-3 cells using 15156-1-AP (SFXN3 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SFXN3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15156-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Sideroflexin-3, sideroflexin 3, SFX3

---

Tested Applications

• Positive WB detected in: C6 cells, Neuro-2a cells, rat brain tissue, NIH/3T3 cells, HeLa cells, mouse brain tissue, SH-SY5Y cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

15156-1-AP targets SFXN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7203

  Product name: Recombinant human SFXN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC000124

  Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP

• Full Name: sideroflexin 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000124
• Gene Symbol: SFXN3
• Gene ID (NCBI): 81855
• RRID: AB_2185825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFXN3, a mitochondrial membrane protein, is a member of sideroflexin family. Serum anti-SFXN3 autoantibody was elevated in early stage of the oral squamous cell carcinoma significantly, indicating its clinical value for diagnosis of oral squamous cell carcinoma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers.; Authors - Mariluz Soula
human	IHC	PeerJ; Identification of iron metabolism-related genes as prognostic indicators for papillary thyroid carcinoma: a retrospective study; Authors - Tiefeng Jin
human,mouse	WB	Nucleic Acids Res; Precise genome editing of the Kozak sequence enables bidirectional and quantitative modulation of protein translation to anticipated levels without affecting transcription; Authors - Jingke Xie
human	WB	Am J Respir Crit Care Med; Distinct Cancer-Promoting Stromal Gene Expression Depending on Lung Function.; Authors - Brian J Sandri