SFXN3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SFXN3 Polyclonal antibody (15156-1-AP)

• Featured Product
• KD/KO Validated

SFXN3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15156-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Sideroflexin-3, sideroflexin 3, SFX3

• 

  WB analysis of HeLa using 15156-1-AP

  WB result of SFXN3 antibody (15156-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SFXN3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15156-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 15156-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15156-1-AP (SFXN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15156-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15156-1-AP (SFXN3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of BxPC-3 using 15156-1-AP

  Immunofluorescent analysis of BxPC-3 cells using 15156-1-AP (SFXN3 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SFXN3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: C6 cells, Neuro-2a cells, rat brain tissue, NIH/3T3 cells, HeLa cells, mouse brain tissue, SH-SY5Y cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15156-1-AP targets SFXN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7203

  Product name: Recombinant human SFXN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC000124

  Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP

• Full Name: sideroflexin 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000124
• Gene Symbol: SFXN3
• Gene ID (NCBI): 81855
• RRID: AB_2185825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFXN3, a mitochondrial membrane protein, is a member of sideroflexin family. Serum anti-SFXN3 autoantibody was elevated in early stage of the oral squamous cell carcinoma significantly, indicating its clinical value for diagnosis of oral squamous cell carcinoma.

Publications

What published studies show

The SFXN3 Polyclonal antibody (Cat# 15156-1-AP) has 4 citations published in Am J Respir Crit Care Med, Nat Chem Biol, Nucleic Acids Res, and PeerJ. The associated research fields include cancer stromal biology, ferroptosis and cancer cell metabolism, genome editing for protein translation modulation, and iron metabolism in thyroid carcinoma.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Respir Crit Care Med; Distinct Cancer-Promoting Stromal Gene Expression Depending on Lung Function.; Authors - Brian J Sandri
human	WB	Nat Chem Biol; Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers.; Authors - Mariluz Soula
human,mouse	WB	Nucleic Acids Res; Precise genome editing of the Kozak sequence enables bidirectional and quantitative modulation of protein translation to anticipated levels without affecting transcription; Authors - Jingke Xie
human	IHC	PeerJ; Identification of iron metabolism-related genes as prognostic indicators for papillary thyroid carcinoma: a retrospective study; Authors - Tiefeng Jin