SGCG Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 18102-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18102-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 18102-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 18102-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 18102-1-AP

  IP result of anti-SGCG (IP:18102-1-AP, 4ug; Detection:18102-1-AP 1:1000) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of human heart using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human placenta using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 18102-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).

SGCG Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18102-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

35 kDa dystrophin-associated glycoprotein, Gamma sarcoglycan, Gamma-sarcoglycan, Gamma-SG

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human skeletal muscle tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 3 publications below
• IP: See 1 publications below

Product Information

18102-1-AP targets SGCG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12402

  Product name: Recombinant human SGCG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-291 aa of BC074777

  Sequence: MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL

• Full Name: sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
• Calculated Molecular Weight: 291 aa, 32 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC074777
• Gene Symbol: SGCG
• Gene ID (NCBI): 6445
• RRID: AB_2286186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13326
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IF	Skelet Muscle; Novel γ-sarcoglycan interactors in murine muscle membranes.; Authors - Tara C Smith
mouse	IHC	PLoS One; Peptide-conjugated phosphodiamidate oligomer-mediated exon skipping has benefits for cardiac function in mdx and Cmah-/-mdx mouse models of Duchenne muscular dystrophy.; Authors - Alison M Blain
human	IF	PLoS One; Correlation of Utrophin Levels with the Dystrophin Protein Complex and Muscle Fibre Regeneration in Duchenne and Becker Muscular Dystrophy Muscle Biopsies.; Authors - Narinder Janghra
human	IF	Hum Gene Ther Methods; Optimisation of internally deleted dystrophin constructs.; Authors - Mojgan Reza
mouse	IHC	Mol Vis; Identification of HMX1 target genes: a predictive promoter model approach.; Authors - Boulling Arnaud A
mouse	WB	Adv Sci (Weinh); Sirt6 Mono-ADP-Ribosylates YY1 to Promote Dystrophin Expression for Neuromuscular Transmission; Authors - Wei Zhang