SGCZ Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SGCZ Polyclonal antibody, PBS Only (21614-1-PBS)

• 

  WB analysis using 21614-1-AP (same clone as 21614-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21614-1-AP (SGCZ antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21614-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21614-1-AP (same clone as 21614-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21614-1-AP (SGCZ antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21614-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 21614-1-AP (same clone as 21614-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using SGCZ antibody (21614-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21614-1-PBS in a different storage buffer formulation.

SGCZ Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 21614-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

---

Product Information

21614-1-PBS targets SGCZ in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16305

  Product name: Recombinant human SGCZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-265 aa of BC125037

  Sequence: SPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS

• Full Name: sarcoglycan zeta
• Calculated Molecular Weight: 265 aa, 30 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC125037
• Gene Symbol: SGCZ
• Gene ID (NCBI): 137868
• RRID: AB_3085662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LD1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sarcoglycan zeta, also known as SGCZ, ZSG1, is part of the sarcoglycan complex. The sarcoglycan complex is part of the dystrophin-associated glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. SGCZ plays a role in the maintenance of striated muscle membrane stability. SGCZ was also found as a component of the vascular smooth muscle sarcoglycan complex. SGCZ was reduced at the membrane in muscular dystrophy (PMID: 12189167).