Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | mouse kidney tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28454-1-AP targets SGK1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29420 Product name: Recombinant human SGK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001263 Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQ Predict reactive species |
| Full Name | serum/glucocorticoid regulated kinase 1 |
| Calculated Molecular Weight | 431 aa, 49 kDa |
| Observed Molecular Weight | 42-50 kDa |
| GenBank Accession Number | BC001263 |
| Gene Symbol | SGK1 |
| Gene ID (NCBI) | 6446 |
| RRID | AB_2881145 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00141 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane (PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation (PMID:16817852). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS/T) (PMID: 11154281). SGK1 promotes cell survival and proliferation in many cancer cell types, including breast, lung, parathyroid, and colon cancers (PMID: 38092114).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SGK1 antibody 28454-1-AP | Download protocol |
| IHC protocol for SGK1 antibody 28454-1-AP | Download protocol |
| WB protocol for SGK1 antibody 28454-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SGK1 antibody (Cat# 28454-1-AP) has 24 citations across journals including Cell Death & Disease, Advanced Science, Molecular Cell, Journal of Biological Chemistry, Free Radical Biology and Medicine, CNS Neuroscience & Therapeutics, Life Sciences, Investigative Ophthalmology & Visual Science, and others. Research fields span oncology (gastric, colorectal, breast, glioblastoma, ovarian, liver cancers), neurology (traumatic brain injury, Alzheimer's, cognitive impairment), inflammation (rheumatoid arthritis, allergic rhinitis), renal disease, osteoporosis, ophthalmology, cardiovascular disease, and reproductive biology.
| Species | Application | Title |
|---|---|---|
Genes Dis Non-canonical role of "S6K1-SGK1" pathway in neuronal necroptosis following traumatic brain injury. | ||
Adv Sci (Weinh) Radiation-Induced Tumor-Intrinsic LTβR N-Glycosylation Suppresses Pyroptosis Through TRIM28-Mediated PCBP2 SUMOylation to Promote Gastric Cancer Radioresistance | ||
Cell Death Dis CircSEC24B activates autophagy and induces chemoresistance of colorectal cancer via OTUB1-mediated deubiquitination of SRPX2 | ||
Cell Death Dis Tumor exosomal circPTBP3 drives gastric cancer peritoneal metastasis via mesothelial-mesenchymal transition | ||
Int J Biol Sci Sodium chloride promotes macrophage pyroptosis and aggravates rheumatoid arthritis by activating SGK1 through GABA receptors Slc6a12 | ||
J Transl Med Around-the-clock noise exposure induces hippocampus apoptosis and subsequent cognitive impairment via the PI3K/SGK1/Foxo3 signaling pathway |
