SGK1 Polyclonal antibody

• 

  IP experiment of HEK-293 using 23394-1-AP

  IP result of anti-SGK1 (IP:23394-1-AP, 4ug; Detection:23394-1-AP 1:600) with HEK-293 cells lysate 1480ug.

• 

  IHC staining of human pancreas using 23394-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23394-1-AP (SGK1 Antibody) at dilution of 1:50.

• 

  IHC staining of human pancreas using 23394-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23394-1-AP (SGK1 Antibody) at dilution of 1:50.

• 

  IHC staining of human breast cancer using 23394-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23394-1-AP (SGK1 Antibody) at dilution of 1:50.

• 

  IHC staining of human breast cancer using 23394-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23394-1-AP (SGK1 Antibody) at dilution of 1:50.

• 

  IF Staining of HEK-293 using 23394-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SGK1 antibody (23394-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SGK1 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 23394-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.7.11.1, Serine/threonine-protein kinase Sgk1, Serum/glucocorticoid-regulated kinase 1, SGK

---

Tested Applications

• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human pancreas tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• IHC: See 1 publications below

Product Information

23394-1-AP targets SGK1 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17888

  Product name: Recombinant human SGK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-431 aa of BC001263

  Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

• Full Name: serum/glucocorticoid regulated kinase 1
• Calculated Molecular Weight: 431 aa, 49 kDa
• GenBank Accession Number: BC001263
• Gene Symbol: SGK1
• Gene ID (NCBI): 6446
• RRID: AB_2879271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00141
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane(PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation(PMID:16817852 ). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS/T)(PMID:11154281). It has 5 isoforms produced by alternative promoter usage and alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Environ Health Perspect; Combined Effects of Polystyrene Nanosphere and Homosolate Exposures on Estrogenic End Points in MCF-7 Cells and Zebrafish; Authors - Rongyi Ye ; KD Validated
human		FASEB J; Inhibition of serum- and glucocorticoid-inducible kinase 1 enhances TLR-mediated inflammation and promotes endotoxin-driven organ failure.; Authors - Huaxin Zhou
mouse		J Innate Immun; Mannan-Binding Lectin Reduces Epithelial-Mesenchymal Transition in Pulmonary Fibrosis via Inactivating the Store-Operated Calcium Entry Machinery.; Authors - Yunzhi Liu
mouse		J Immunol; Serum- and Glucocorticoid-Inducible Kinase 1 Promotes Alternative Macrophage Polarization and Restrains Inflammation through FoxO1 and STAT3 Signaling.; Authors - Junling Ren
mouse	IHC	J Transl Med; Hepatocyte SGK1 activated by hepatic ischemia-reperfusion promotes the recurrence of liver metastasis via IL-6/STAT3; Authors - Xiangdong Li
human		Appl Biochem Biotechnol; Long Non-coding RNA ZFAS1 Regulates Fibrosis and Scortosis in the Cell Model of Diabetic Nephropathy Through miR-525-5p/SGK1 Axis; Authors - Langen Zhuang