SGTB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SGTB Polyclonal antibody, PBS Only (15895-1-PBS)

• 

  WB analysis using 15895-1-AP (same clone as 15895-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15895-1-AP (SGTB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15895-1-PBS in a different storage buffer formulation.

SGTB Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15895-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15895-1-PBS targets SGTB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8709

  Product name: Recombinant human SGTB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC012044

  Sequence: MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSAEEHS

• Full Name: small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
• Calculated Molecular Weight: 304 aa, 33 kDa
• Observed Molecular Weight: 33-36 kDa
• GenBank Accession Number: BC012044
• Gene Symbol: SGTB
• Gene ID (NCBI): 54557
• RRID: AB_2918042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.