SH3BP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68328-1-Ig (same clone as 68328-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68328-1-Ig (SH3BP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68328-1-Ig (same clone as 68328-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68328-1-Ig (SH3BP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68328-1-Ig (same clone as 68328-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68328-1-Ig (SH3BP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68328-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68328-1-Ig (same clone as 68328-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SH3BP1 antibody (68328-1-Ig, Clone: 1B12C6 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68328-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 68328-1-Ig (same clone as 68328-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug SH3BP1 Monoclonal antibody (68328-1-Ig, Clone:1B12C6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68328-1-PBS in a different storage buffer formulation.

SH3BP1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 68328-1-PBS

Clone No.1B12C6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1B12C6, 3BP 1, SH3 domain binding protein 1, SH3 domain-binding protein 1

---

Product Information

68328-1-PBS targets SH3BP1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15165

  Product name: Recombinant human SH3BP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC008282

  Sequence: MAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPN

• Full Name: SH3-domain binding protein 1
• Calculated Molecular Weight: 701 aa, 76 kDa
• Observed Molecular Weight: 76-80 kDa
• GenBank Accession Number: BC008282
• Gene Symbol: SH3BP1
• Gene ID (NCBI): 23616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3L3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH3BP1 is also named as Chimeric SH3BP1-PDXP protein and BARGIN, and belongs to the to the RhoGAP family. SH3BP1 can be as a partner of the exocyst complex and establish a physical and functional link between two motility-driving pathways, the Ral/exocyst and Rac signaling pathways. (PMID:21658605). SH3BP1 localizes together with the exocyst to the leading edge of motile cells and that SH3BP1 regulates cell migration via its GAP activity upon Rac1.