SH3BP4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68045-1-Ig (same clone as 68045-1-PBS)

  Various cell lysates were subjected to SDS PAGE followed by western blot with 68045-1-Ig (SH3BP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 68045-1-PBS in a different storage buffer formulation.

SH3BP4 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68045-1-PBS

Clone No.2G4H3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

BOG25, EH binding protein 10, EHB10, SH3 domain binding protein 4, SH3BP4, TTP

---

Product Information

68045-1-PBS targets SH3BP4 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31238

  Product name: Recombinant human SH3BP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-193 aa of BC057396

  Sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPSLDELNPKSTVDLL

• Full Name: SH3-domain binding protein 4
• Calculated Molecular Weight: 963 aa, 108 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC057396
• Gene Symbol: SH3BP4
• Gene ID (NCBI): 23677
• RRID: AB_2918787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P0V3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.