SH3BP5L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SH3BP5L Polyclonal antibody (27446-1-AP)

• 

  WB analysis using 27446-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27446-1-AP (SH3BP5L antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 27446-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27446-1-AP (SH3BP5L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 27446-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27446-1-AP (SH3BP5L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SH3BP5L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27446-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

KIAA1720, SH3BP 5 like

---

Tested Applications

• Positive WB detected in: 769-P cells, PC-3 cells, RKO cells, THP-1 cells
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27446-1-AP targets SH3BP5L in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23990

  Product name: Recombinant human SH3BP5L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-393 aa of BC017254

  Sequence: QFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPEDMEDGDSGIEGAEGAGLEEGSSLGPGPAPDTDTLSLLSLRTVASDLQKCDSVEHLRGLSDHVSLDGQELGTRSGGRRGSDGGARGGRHQRSVSL

• Full Name: SH3-binding domain protein 5-like
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC017254
• Gene Symbol: SH3BP5L
• Gene ID (NCBI): 80851
• RRID: AB_3742231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8J4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SH3BP5L (SH3 Binding Domain Protein 5 Like) is a protein-coding gene that encodes a protein with a conserved N-terminus and functions as a guanine nucleotide exchange factor (GEF) for Rab11 GTPases.