SHANK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SHANK2 Polyclonal antibody, PBS Only (27272-1-PBS)

• 

  WB analysis using 27272-1-AP (same clone as 27272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27272-1-AP (SHANK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27272-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 27272-1-AP (same clone as 27272-1-PBS)

  IP result of anti-SHANK2 (IP:27272-1-AP, 4ug; Detection:27272-1-AP 1:1000) with mouse brain tissue lysate 1600 ug. This data was developed using the same antibody clone with 27272-1-PBS in a different storage buffer formulation.

SHANK2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 27272-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

SHANK, ProSAP1, KIAA1022, CTTNBP1, CORTBP1

---

Product Information

27272-1-PBS targets SHANK2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26101

  Product name: Recombinant human SHANK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-490 aa of NM_012309

  Sequence: VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP

• Full Name: SH3 and multiple ankyrin repeat domains 2
• Calculated Molecular Weight: 159 kDa
• Observed Molecular Weight: 158-200 kDa
• GenBank Accession Number: NM_012309
• Gene Symbol: SHANK2
• Gene ID (NCBI): 22941
• RRID: AB_3742227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH3 and multiple ankyrin repeat domains protein 2 (SHANK2) is also named as CORTBP1, KIAA1022, PROSAP1. SHANK2 code a scaffolding protein located at the postsynaptic membrane of glutamatergic neurons (PMID: 32987185). SHANK2 encodes for a postsynaptic scaffolding protein at glutamatergic synapses in the brain, essential for proper synapse formation, development and plasticity (PMID: 11283303, PMID: 12065602). As SHANK2 directly interacts with IRSp53 (insulin receptor substrate p53), it may be involved in insulin signaling in the brain, making this pathway susceptible to SHANK2 mutations (PMID: 33483523). In the SFARI gene database, SHANK2 is categorized as a high confidence autism risk gene. In addition, SHANK2 has been linked to the pathology of neuropsychiatric (schizophrenia, bipolar disorder) and neurodegenerative disorders (PMID: 33483523).